Protein Info for TX73_010325 in Rhodopseudomonas palustris CGA009

Annotation: c-type cytochrome

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 330 to 407 (78 residues), 27.3 bits, see alignment E=7.5e-10 amino acids 575 to 662 (88 residues), 28.7 bits, see alignment E=2.7e-10 PF00034: Cytochrom_C" amino acids 331 to 410 (80 residues), 34.7 bits, see alignment E=7.5e-12 amino acids 577 to 664 (88 residues), 36.9 bits, see alignment E=1.6e-12 PF21342: SoxA-TsdA_cyt-c" amino acids 479 to 546 (68 residues), 41.2 bits, see alignment E=2.7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2003)

Predicted SEED Role

"Putative diheme cytochrome c-553" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (689 amino acids)

>TX73_010325 c-type cytochrome (Rhodopseudomonas palustris CGA009)
MSHSRGRTAKTLAFLAASALVVIGGAALWIIQPPAVDTKLKPVDAQVDPELIKRGEYIAR
AGDCVACHTAPGGTPMAGGLKLDTPFGSLWSTNITPDRATGIGSWSFGEFDRAMRKGVAA
DGHNLYPAMPYPSYAKISSDDMVALWAYLTKGLAPVAQANRAPEMSFPFNMRIGLAFWNV
AFLDASPFKPEPNQDAVWNRGAYLVQGLGHCGACHTPRGIAFQEKAMSDAGPHGRDYLAG
AKVENWNALNLRGLWTVPDTVQMLKTGQNRFATAAGGMTDVIRHSTQHMTDQDLTAIATY
LKALPTDRPAPAIAVAEVPASTYSTPGGLGYTQFCADCHRADGAGVPGVFPPLAGNPTIA
AKDPATLVHITLTGWETTATTAHPRVWTMPSFARLNDREIADILSFVRANWGGNASAVTA
EQIVAARAALDPKIDTSRFETPRIADILSQPNAEQLVRGMRLNAETHTLLPNNVGNDLNC
SSCHLNAGTVADGSPYVGVAAFFPSYAPRAGRVITLEDRINGCFLRSMNGKPLPVDGPDM
KAMVAYFDWMQGSTKPEDKVAGRGVGKVDQSLVPNLDNGKEIYTARCAVCHGDNGEGLKD
AAGRVVYPPLWGPRSFNIGAGMARTYTAAAFVKRNMPIASHNKFPLGQGELSDQEAVDVA
AYFTHMERPDFPGKVKDWPKDQKPKDARY