Protein Info for TX73_010205 in Rhodopseudomonas palustris CGA009

Annotation: HAD-IA family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00702: Hydrolase" amino acids 6 to 184 (179 residues), 92.2 bits, see alignment E=1.2e-29 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 7 to 217 (211 residues), 171.1 bits, see alignment E=3.5e-54 PF13419: HAD_2" amino acids 7 to 190 (184 residues), 106.4 bits, see alignment E=3.8e-34 PF12710: HAD" amino acids 7 to 180 (174 residues), 41.1 bits, see alignment E=5.5e-14 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 106 to 184 (79 residues), 26.4 bits, see alignment E=1.2e-09 PF13242: Hydrolase_like" amino acids 146 to 213 (68 residues), 33.2 bits, see alignment E=7.9e-12

Best Hits

Swiss-Prot: 48% identical to GPH_CAUVC: Phosphoglycolate phosphatase (gph) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to rpt:Rpal_2193)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>TX73_010205 HAD-IA family hydrolase (Rhodopseudomonas palustris CGA009)
MTASPIVVFDLDGTLIDTAPDLINALNFILVREGMPAVPMAVARNMIGQGARRLLERGLE
LDGRVIAQDDVNRLTVDFIDYYAAHIADESRPFEGLEATLDELSESGYRFAVCTNKLEWL
SKLLLDRLGLSPRFAAICGADTFGVAKPDPAILRETVAKAGGDLSAAIMVGDAGPDVGVA
RRAGVPVIGVEFGYTEVPIAELQPDLLVGHMRELPNAVGRLLPRR