Protein Info for TX73_010050 in Rhodopseudomonas palustris CGA009

Annotation: pyrroloquinoline quinone biosynthesis peptide chaperone PqqD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03859: coenzyme PQQ biosynthesis protein PqqD
  • amino acids 14 to 94 (81 residues), 81.3 bits, E=1.8e-27
• PF05402: PqqD
  • amino acids 31 to 94 (64 residues), 65.8 bits, E=1.8e-22

Best Hits

Swiss-Prot: 100% identical to PQQD_RHOPA: PqqA binding protein (pqqD) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K06138, pyrroloquinoline quinone biosynthesis protein D (inferred from 100% identity to rpa:RPA1949)

Predicted SEED Role

"Coenzyme PQQ synthesis protein D" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Protein Sequence (102 amino acids)

>TX73_010050 pyrroloquinoline quinone biosynthesis peptide chaperone PqqD (Rhodopseudomonas palustris CGA009)
MAPRRISVSETCRPVLPRHARLKFDDTRQRWVILAPERVLAPDEIAVEILQLCDGACDVA
AIIDALAAKYTADRAEIGRDVMAMLQDLADKGFLTEARETAP