Protein Info for TX73_010045 in Rhodopseudomonas palustris CGA009

Annotation: pyrroloquinoline-quinone synthase PqqC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR02111: coenzyme PQQ biosynthesis protein C" amino acids 18 to 252 (235 residues), 364.8 bits, see alignment E=9e-114 PF03070: TENA_THI-4" amino acids 23 to 233 (211 residues), 174.3 bits, see alignment E=1.6e-55

Best Hits

Swiss-Prot: 100% identical to PQQC_RHOPA: Pyrroloquinoline-quinone synthase (pqqC) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K06137, pyrroloquinoline-quinone synthase [EC: 1.3.3.11] (inferred from 100% identity to rpa:RPA1948)

MetaCyc: 43% identical to pyrroloquinoline-quinone synthase monomer (Klebsiella pneumoniae)
Pyrroloquinoline-quinone synthase. [EC: 1.3.3.11]

Predicted SEED Role

"Pyrroloquinoline-quinone synthase (EC 1.3.3.11)" (EC 1.3.3.11)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>TX73_010045 pyrroloquinoline-quinone synthase PqqC (Rhodopseudomonas palustris CGA009)
MNAMTAFSLNGAAPLANADELEAALRQIGAARYHNLHPFHRLLHGGKLNKGQVQAWALNR
YYYQSSIPIKDAVVISRFRDRATRVEWRHRIEDHDGDLSSEGGIERWLKLTEGLGLDSGY
VESTQGILPATRFAVDAYVHFVRDRTPLEAIASSLTELFAPNLHEERIAGMLAHYDFVNP
EIMSYFKRRLEQAPRDADFALRHVKQHATTPAEREAVCNALIFKTNVLWAQLDALHHAYV
DGHIPPGAFVPQGF