Protein Info for TX73_009960 in Rhodopseudomonas palustris CGA009

Annotation: HAMP domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details PF00672: HAMP" amino acids 180 to 232 (53 residues), 53.5 bits, see alignment 3.6e-18 PF00512: HisKA" amino acids 240 to 303 (64 residues), 35.3 bits, see alignment E=1.4e-12 PF02518: HATPase_c" amino acids 348 to 465 (118 residues), 75.7 bits, see alignment E=5.9e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_2143)

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>TX73_009960 HAMP domain-containing sensor histidine kinase (Rhodopseudomonas palustris CGA009)
MTAFGKLIRTTAFRLTLVYLFLFGLFAASLVAYFAWTTRKLITDQITTTVDAEIAEINDI
YGRRGLRGVVFTLENRALRPGANLYLVTTPAGQAVAGNVGALAPGVMSKNGWSETFYRRL
DDQERSDHRALVRVTELSSGFRLLVGRDLEERRRLNKVVRSAAQWSVLIVVVLGLGGGVF
AARRVLRRIDAMTGTTQRIMAGDLSGRLPVGRSGDELDRLAENLNAMLERIEALMSGMKE
VSDNIAHDLKTPLTRLRNRAEEALARAASESDYRVALERTIEESDGLIRTFNALLMIARA
EAGYASGDMTDFDAAEIARDIHELYEPLAEDNALTLQVEALAAPVRGNRELISQALANLV
ENAIKYGKPQPAADADVPAATGTVQIEARRDGDQVLLSVTDHGIGIPEGDRKHAIERFVR
LEASRTLPGSGLGLSLASAVARLHGGELRLADADPGLRATLAIPARTGEGQASATTLEPA
PA