Protein Info for TX73_009905 in Rhodopseudomonas palustris CGA009
Annotation: cytochrome c-type biogenesis protein CcmH
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 69% identical to CCMH_BRADU: Cytochrome c-type biogenesis protein CcmH (ccmH) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 100% identity to rpa:RPA1922)Predicted SEED Role
"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (165 amino acids)
>TX73_009905 cytochrome c-type biogenesis protein CcmH (Rhodopseudomonas palustris CGA009) MRKLFAALLIVFATVVASPLAHAVQPDEVMADPKQESRARELSRELRCMVCQNQSIDDSD ATLAKDLRLLVRERIAAGDSNKQVIDYLVSRYGEFVLLKPRFETHTLLLWLLPPLVLVAG GLGLWLHIRRRSRDAARASDAPKPLSADEQARLDKLLAEGADQAP