Protein Info for TX73_009395 in Rhodopseudomonas palustris CGA009

Annotation: TIGR03808 family TAT-translocated repetitive protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR03808: twin-arg-translocated uncharacterized repeat protein" amino acids 1 to 452 (452 residues), 803.6 bits, see alignment E=4.5e-246 PF12708: Pectate_lyase_3" amino acids 40 to 210 (171 residues), 29.8 bits, see alignment E=7.7e-11 PF13229: Beta_helix" amino acids 134 to 209 (76 residues), 34.1 bits, see alignment E=3.1e-12 amino acids 213 to 385 (173 residues), 43.8 bits, see alignment E=3.3e-15 PF05048: NosD" amino acids 136 to 239 (104 residues), 30.6 bits, see alignment E=3.5e-11 TIGR03807: putative cofactor-binding repeat" amino acids 277 to 305 (29 residues), 18.6 bits, see alignment (E = 1.4e-07) amino acids 309 to 330 (22 residues), 33.6 bits, see alignment (E = 2.9e-12) amino acids 339 to 365 (27 residues), 46.3 bits, see alignment (E = 2.9e-16) amino acids 366 to 391 (26 residues), 40.6 bits, see alignment (E = 1.8e-14)

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA1826)

Predicted SEED Role

"Bll3046 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>TX73_009395 TIGR03808 family TAT-translocated repetitive protein (Rhodopseudomonas palustris CGA009)
MALHRRDFLTALATGSALTLTASPLTAAPTSRRGRDAALSGVRPDSSDDQTSALQRAIDD
AAERHVPLALPPGNYRTGTLRLPSGTQLSGVRGATRLIFTGGPSLFDSQGAETATLSGLV
LDGAGIPLPSRRGLVHCIAAQDLRIENCMITASGGSGIWLEASSGAISNNMLTKIAVTGV
VSFDAKGLRVDGNTIIDTNDNGIEILRTSIGDDGTLVTGNRIENIKAGPGGSGQYGNAIN
AFRAGNVVISGNRIKDCDYSAVRGNSASNIQITGNSVLNVREVALYSEFAFEGAVINNNT
VDGAALGVSVCNFNEGGRLSTVQGNIIRNLKPKRPIGTAPDDDAGIGIYVEADTAVSGNV
IENAPSFGIVAGWGRYLRDVAITGNVVRKSFIGIGVSVVDGAGTATISGNVIAETPRGAV
VGLDHARPVTPDLTTPGSTRFNQVSLGHNTTR