Protein Info for TX73_009330 in Rhodopseudomonas palustris CGA009

Annotation: DUF1109 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details PF06532: NrsF" amino acids 10 to 212 (203 residues), 200.6 bits, see alignment E=1.3e-63

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpt:Rpal_2017)

Predicted SEED Role

"FIG01005137: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>TX73_009330 DUF1109 domain-containing protein (Rhodopseudomonas palustris CGA009)
METDRLIQALAADGARRDRPVGQVLAAALLVALPVSAALLLTTLGLRPDLHQAMRNPFFD
LKFVVTLSLSLSAIIVALHLSRPEATAKGWRLLLLAPLAILGLAIGVEAMLPHRTSAMTR
LLGHNSLLCLGSIPALSLPILGAALLGLRRGAPSRPALAGALAGMLSAGLAGTLYAAHCV
DDSPLFVATWYTLATAMVAGLGALLGRRVLRY