Protein Info for TX73_009170 in Rhodopseudomonas palustris CGA009

Annotation: TRAP transporter small permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details PF04290: DctQ" amino acids 20 to 149 (130 residues), 83.5 bits, see alignment E=6.2e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_1985)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>TX73_009170 TRAP transporter small permease (Rhodopseudomonas palustris CGA009)
MDRFIDAIEWIAAFFVGIVALNTFLAVFMRKFFSVTIPDYYNFGQFMLGVLIFWGIAATS
YRGSHITVDLVWAAASPRWQRIIDIFATLVLLFVVSVQTYTLFDKVVTTKADHIVTMDLQ
IPIWPFYLVSWIGDVSAVLLIAIRTFRLIFHPEQMREVRMKPVE