Protein Info for TX73_009070 in Rhodopseudomonas palustris CGA009

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF00106: adh_short" amino acids 12 to 199 (188 residues), 124.9 bits, see alignment E=4.4e-40 PF08659: KR" amino acids 12 to 127 (116 residues), 31.9 bits, see alignment E=1.8e-11 PF13561: adh_short_C2" amino acids 19 to 250 (232 residues), 138.6 bits, see alignment E=4e-44

Best Hits

Swiss-Prot: 42% identical to DECR_RAT: 2,4-dienoyl-CoA reductase, mitochondrial (Decr1) from Rattus norvegicus

KEGG orthology group: None (inferred from 99% identity to rpx:Rpdx1_3767)

Predicted SEED Role

"hypothetical oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>TX73_009070 SDR family oxidoreductase (Rhodopseudomonas palustris CGA009)
MFTDQLLAGRRILVTGGGTGLGKAMAARFLQLGAEVHICGRRKGVCDETATELMDQYGGK
VMTYGVDIRDAAAVDHMVETIFESGPLTDLINNAAGNFISRSEDLSPRGFDAVANIVMHG
TFYVTHAVGKRWIAGGHRGNVVSITTTWVRNGSPYVVPSAMSKSAIHAMTMSLATEWGKY
GIRLNTIAPGEIPTEGMSKRIKPGDEAGARTIKMNPMGRVGTMEELQNLATFLISGGCDW
ISGETIAMDGAQGLAMGGNFYQLRDWSNADWDQAKASIKAQNEKDRAQRG