Protein Info for TX73_008925 in Rhodopseudomonas palustris CGA009

Annotation: SbmA/BacA-like family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 310 to 326 (17 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 32 to 232 (201 residues), 62.8 bits, see alignment E=3.5e-21 PF05992: SbmA_BacA" amino acids 36 to 345 (310 residues), 71.4 bits, see alignment E=9.7e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_1935)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>TX73_008925 SbmA/BacA-like family transporter (Rhodopseudomonas palustris CGA009)
MGLFSHNDSNGHNLTGFWLMSRRFWLSGKPRVTGLIVVLIGVVLAQLLVQFYLNLWNRHF
FDALERRDAGALWTQTGIFVMLAATSVLVAATSVWGRMTGQRKWRESMTCEILARWSRKD
HNVPIDGTDHGAENPEYRLAEDVRIATDSPVDLILAFLSSVLTALTFFSVLWSVGGSIDV
TVFGHRAEIPGYLVVGVIGYSTLMTALMLWFGRRMTSISERRNQNEAEFRAAAEVMRGGR
PASEADEKAWMIKLAERLKAVLRSWRELCWQLVDMTLVSHSNFLFAPVAAYFLCFPKYLA
GAMTLGEVTQSAAAFVTVQGAVNWLVDNYQRLADWRSSANRVAALLAAIDAMPDRNPATP
AEPSRELASP