Protein Info for TX73_008875 in Rhodopseudomonas palustris CGA009

Annotation: phenylacetic acid degradation bifunctional protein PaaZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02278: phenylacetic acid degradation protein paaN
  • amino acids 5 to 676 (672 residues), 1200.8 bits, E=0
• PF00171: Aldedh
  • amino acids 26 to 445 (420 residues), 204.4 bits, E=2.6e-64
• PF01575: MaoC_dehydratas
  • amino acids 541 to 655 (115 residues), 86.9 bits, E=8.5e-29

Best Hits

KEGG orthology group: K02618, phenylacetic acid degradation protein (inferred from 100% identity to rpa:RPA1725)

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3), PaaZ" in subsystem Aromatic Amin Catabolism (EC 1.2.1.3)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• phytol degradation (3/4 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• putrescine degradation III (2/4 steps found)
• serotonin degradation (4/7 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• dopamine degradation (2/5 steps found)
• octane oxidation (2/5 steps found)
• aromatic biogenic amine degradation (bacteria) (3/8 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• limonene degradation IV (anaerobic) (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3

Protein Sequence (679 amino acids)

>TX73_008875 phenylacetic acid degradation bifunctional protein PaaZ (Rhodopseudomonas palustris CGA009)
MTAILQSLACDRWETPATGLVDIPSAIDGRVVARASSAGLDFAAIARHARQVGGPKLRAM
TFHQRADMLKALGAYLGERKEQLYALAADTGANRRDNAIDIDGSLVTLAAFASRGRRELP
DAGFITEGEVEALSKRGSFVGQHILTPLHGVAVHINAFNFPCWGLLEKLAPALLAGVPVI
AKPATATAYVAEALVKMIDESKLLPQGALQLVCGGLGDLLDHLNGQDVIAFTGSLETSEK
LRAHPNVARHSIRFIAERDSLNAAVLGPDIKPADPEFDLFAHEIVREMTAKAGQKCTAIR
RVLVPRAQEAAVIEALKARLADVKLGDPRRDDKAMGPLVSRGQREAVRAAIATLQSEAEI
VFGDPNVCEAEGIDTQAGAYMSPVLLRAREPMQASHVHATEAFGPVATVLAYDDVAQAVE
LVRRGEGSLVASLFTYDDVVAEQMILGLAPFHGRLLIVDRDDAAESTGHGTPLPALLHGG
PGRAGGGEELGGLRSVYHYMQRTAIQCSPRRLARLTGTWTRGAPAPAAEVHPFKLNYNQL
EIGQSIETASRPITLDDIEHFAHFTGDTFYAHMDEAAAKANPFFPGRVAHGYLILAFAAG
LFVDPAPGPLLANYGLDNLRFLKPVSPDDSIKVKLTVKQKSPARRPEYGEVRWDVEVVNQ
NGEPVARYDLLTMSARPAA