Protein Info for TX73_008870 in Rhodopseudomonas palustris CGA009

Annotation: hydroxyphenylacetyl-CoA thioesterase PaaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02286: phenylacetic acid degradation protein PaaD
  • amino acids 32 to 144 (113 residues), 168.9 bits, E=3.8e-54
• TIGR00369: uncharacterized domain 1
  • amino acids 32 to 139 (108 residues), 73.2 bits, E=1.8e-24
• PF03061: 4HBT
  • amino acids 61 to 132 (72 residues), 51.2 bits, E=6.6e-18

Best Hits

Swiss-Prot: 45% identical to PAAI_ECOLI: Acyl-coenzyme A thioesterase PaaI (paaI) from Escherichia coli (strain K12)

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 100% identity to rpa:RPA1724)

MetaCyc: 45% identical to phenylacetyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-; 3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Protein Sequence (157 amino acids)

>TX73_008870 hydroxyphenylacetyl-CoA thioesterase PaaI (Rhodopseudomonas palustris CGA009)
MTAAAPQTQAEPSPDQLARACADAMWANDHASKALGMEIVEIGAGSATLAMTVTTDMVNG
HGIAHGGFIFTLADSAFAYACNSYNDSTVAAQGAITFIRPGKLGARLVAAAREVSRSGRS
GIYDVRVTSGSTVIAEFRGHSRSIGGTLVPPQQPDPR