Protein Info for TX73_008590 in Rhodopseudomonas palustris CGA009

Annotation: bifunctional serine/threonine-protein kinase/universal stress protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 198 to 216 (19 residues), see Phobius details PF00069: Pkinase" amino acids 18 to 267 (250 residues), 101.4 bits, see alignment E=1.8e-32 PF07714: PK_Tyr_Ser-Thr" amino acids 36 to 269 (234 residues), 64.8 bits, see alignment E=2.5e-21 PF03109: ABC1" amino acids 74 to 160 (87 residues), 26.7 bits, see alignment E=8.7e-10 PF06293: Kdo" amino acids 83 to 156 (74 residues), 23.6 bits, see alignment E=9.4e-09 PF00582: Usp" amino acids 323 to 461 (139 residues), 55.6 bits, see alignment E=2.6e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA1671)

Predicted SEED Role

"Serine/threonine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>TX73_008590 bifunctional serine/threonine-protein kinase/universal stress protein (Rhodopseudomonas palustris CGA009)
MDEVTFEPGSTIDGFIIEEAIHRGGMATLFKVRRDDDPTPMVMKIPRIGEGEDPAAIVSF
EMEQMLMPRLSGPHVPKFVAMQDFSTQPYIVMERIAGEPLLARLPELPLGYDEAVAIAAK
IATAIADLHRQHVIHHDIKPSNIMFRPSGEAVLLDMGLACSDQLPDLMQEEFRLPFGTAP
YMAPERLLGVRDEPRSDLFALGVLLYFFTTGVRPFGETETMYGMRRRLWRDPHPPRKLRP
DYPLWLQEIVLRCLEIEPAWRYPTAAQLVFDLTHPSEVKLTTRSEKLKHDPLRTVLRRRF
NKELTRPRAVESMAAHLASAPIVAVAIDVAEGSGALNDALRTTASRILATLPSARLACLN
VLKLGRMTIDRTLDEHGHNKHVDRLVQLRHWAEPLKLEDDRLTVHVLEAVDPASAILEFA
QASRVDHILIGARRSSVLRSLLGSVSAKVAGEASCTVTIVREPQLASPRSGPRAGAQDA