Protein Info for TX73_008515 in Rhodopseudomonas palustris CGA009

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 218 to 381 (164 residues), 141.5 bits, see alignment E=1.1e-45 PF00990: GGDEF" amino acids 221 to 377 (157 residues), 140.1 bits, see alignment E=2.8e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_1852)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>TX73_008515 GGDEF domain-containing protein (Rhodopseudomonas palustris CGA009)
MLSMPTLWIVFLINFVSLGLVWVHVTRNYPNFTPARYMTAACFVLATGSVVGMLRIVINV
ELSLIGGGTLVVFACCLSAMGMYEFYGRRVPWMTSFIVTGTAALGLTFFIFVVDSMAMRI
LVYSLAQLVPIALTLPLVTSKVGRRNPGARMAAVIACLIMAVYLVRSVAAIMGVGGELSL
VHFNDFQSALVLALVFLSMTWNFAFLLMAIDRLRSEVENLALLDDLTGISNRRHLLQRMS
EQCTLSMSTGEPFAVLAIDLDGFKAINDGHGHAAGDECLRRFSRAAQSRLRPGDLLARAG
GDEFCVVMPGTTLREGAMIARYILDESRAVSERGEAGIKIAASIGIAQWTPQIGQHPERL
IAAADVALYNAKKLGKDRYAVYEPAPEPPPETHLPTPETLRKIA