Protein Info for TX73_008475 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 325 to 354 (30 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 23 to 253 (231 residues), 52.3 bits, see alignment E=9.4e-18 PF02687: FtsX" amino acids 285 to 402 (118 residues), 66 bits, see alignment E=3.2e-22

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to rpt:Rpal_1840)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>TX73_008475 ABC transporter permease (Rhodopseudomonas palustris CGA009)
MKRWLPFEWIAAVRFLLDGAVQTLVIVGGIAIGVGVIVFMSAMLAGLQANFIKRVLTSVP
QIQLLPPDQVARPLRDQPGTVEAAVVQRPTQRMISIDQWPKIRAEMQARPDVVYAAATAS
GSALALRGDTSRAVTLYGIEPEIYFKIVKVPDFIVAGEAQVTTEGILIGIELARDLGASL
GDKIIVSTPLAGNRILTIKGIFDFGNKAANQRNTFVTLRNAQSMLGLIGGVTSIDLTVED
IYAAETIAQEIQAMLQVKADSWIKTNAQFFTAVQAQQNSNTLIRLFVGLSVAFGIAAVLI
VSVIQRSKDIGILRAMGTRRGQILRVFLIQGGLLAFVGSVLGSAFGALALFTWHRSARQV
DGSELFPLILDPDLFVWAAVLATATGVAAAIAPALRAARLDPVVAIRG