Protein Info for TX73_008470 in Rhodopseudomonas palustris CGA009

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 79 to 126 (48 residues), 39 bits, see alignment 1.1e-13 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 211 to 403 (193 residues), 127.5 bits, see alignment E=2.8e-41 PF16576: HlyD_D23" amino acids 220 to 338 (119 residues), 73.4 bits, see alignment E=3.4e-24 PF13437: HlyD_3" amino acids 234 to 328 (95 residues), 54.2 bits, see alignment E=4.2e-18

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 100% identity to rpa:RPA1648)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>TX73_008470 efflux RND transporter periplasmic adaptor subunit (Rhodopseudomonas palustris CGA009)
MLENVEQIDTPRPNLAVRWAGGLWRHKWPVLGIALVLIAAGLGLARLLLGPEVVAALVQR
GNLVQTVVASGHIETPYRVEIASQITGTVKDVLVKEGEQVHQGQQLVAIEASELQASVVQ
AEGAVAQAQARVRQLRELTKPAADEALKQAQANLLNAQAAYERASKLAASGYGTKATLDD
ATKNLDVARTQVRTAELQVFTTSPGGSDFVMAETQLGQALANLNTAQARLGYATIVAPRD
GVLITRNVERGTVVQPGKALLVLAPAGDIQIVVQIDEKNLGQLALGQHAMASADAYPDKR
FDATLSYINPSVDINRASVEIKLKVDDPPDYLRQDMTVSVDIATARRDDVVIVPARAVND
AAAAPYVLKASGGRAVRQPVKLGLRGVGFYEVIDGLVPGDRVIPLATGVKPDQRIRAVLR