Protein Info for TX73_008160 in Rhodopseudomonas palustris CGA009

Annotation: 30S ribosomal protein S4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01017: ribosomal protein uS4
  • amino acids 6 to 205 (200 residues), 234.6 bits, E=4.2e-74
• PF00163: Ribosomal_S4
  • amino acids 6 to 93 (88 residues), 89.6 bits, E=2.8e-29
• PF01479: S4
  • amino acids 94 to 141 (48 residues), 74 bits, 9.3e-25

Best Hits

Swiss-Prot: 100% identical to RS4_RHOPA: 30S ribosomal protein S4 (rpsD) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K02986, small subunit ribosomal protein S4 (inferred from 100% identity to rpa:RPA1589)

MetaCyc: 51% identical to 30S ribosomal subunit protein S4 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S4p (S9e)" in subsystem Ribosome SSU bacterial

Protein Sequence (205 amino acids)

>TX73_008160 30S ribosomal protein S4 (Rhodopseudomonas palustris CGA009)
MTKRAEAKYKIDRRMGQNIWGRPKSPVNRREYGPGQHGQRRKGKLSDFGVQLRAKQKLKG
YYANISERQFHAIYVEATRLKGDSGENLIGLLERRLDAVVYRAKFVSTMFAARQFINHGH
IKVNGKRVNIPSYKVRVGDVIEVKEASKQLAFVLEASQLAERDVPDYIEVDHNKMTAKFA
RIPALSDVPFAVQMEPHLIVEFYSR