Protein Info for TX73_008055 in Rhodopseudomonas palustris CGA009

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF07224: Chlorophyllase" amino acids 23 to 122 (100 residues), 23.6 bits, see alignment E=1.3e-08 PF00561: Abhydrolase_1" amino acids 27 to 142 (116 residues), 85 bits, see alignment E=3.4e-27 PF12697: Abhydrolase_6" amino acids 27 to 256 (230 residues), 93.4 bits, see alignment E=1.7e-29 PF12146: Hydrolase_4" amino acids 27 to 250 (224 residues), 74.7 bits, see alignment E=3.5e-24 PF00975: Thioesterase" amino acids 48 to 113 (66 residues), 41.2 bits, see alignment E=1.1e-13 PF06821: Ser_hydrolase" amino acids 71 to 127 (57 residues), 22.5 bits, see alignment E=4.7e-08 PF00756: Esterase" amino acids 73 to 119 (47 residues), 22.1 bits, see alignment 5.5e-08 PF03959: FSH1" amino acids 193 to 245 (53 residues), 23.1 bits, see alignment E=2.7e-08 PF08386: Abhydrolase_4" amino acids 201 to 248 (48 residues), 27.9 bits, see alignment 1.1e-09

Best Hits

KEGG orthology group: K01044, carboxylesterase [EC: 3.1.1.1] (inferred from 100% identity to rpa:RPA1568)

Predicted SEED Role

"bll1234; putative hydolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>TX73_008055 alpha/beta hydrolase (Rhodopseudomonas palustris CGA009)
MQIKVNGTDTFVATGGKPFDASLPAAVFIHGAGFDHSVWALQTRWFAHHGFAVLAPDLPG
HGRSGGEALKTIAEMADWIAALLDATGAQPAKLIGHSMGSLIALEAAARHPAKVASLALI
GTTSTMAVGPDLLKAAEANDPAAIAMMTIWGLGPDAEIGGNLAPGLWMHGGSVRVLEANR
PGVIFNDLSACNDYKDALAAAAKVTVPTLFILGERDMMTPTKNGKTLAAAISGSRTVILK
GAGHTMMVERPDEVLKALQQ