Protein Info for TX73_008020 in Rhodopseudomonas palustris CGA009

Annotation: CbbX protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 TIGR02880: CbbX protein" amino acids 18 to 300 (283 residues), 534.9 bits, see alignment E=2.1e-165 PF00004: AAA" amino acids 78 to 209 (132 residues), 63.1 bits, see alignment E=9.5e-21 PF07728: AAA_5" amino acids 79 to 146 (68 residues), 23.1 bits, see alignment E=1.6e-08 PF17866: AAA_lid_6" amino acids 233 to 294 (62 residues), 57.3 bits, see alignment E=3.4e-19

Best Hits

Swiss-Prot: 75% identical to CBBX_RHOSH: Protein CbbX (cbbX) from Rhodobacter sphaeroides

KEGG orthology group: None (inferred from 100% identity to rpa:RPA1561)

Predicted SEED Role

"probable RuBisCo-expression protein CbbX" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>TX73_008020 CbbX protein (Rhodopseudomonas palustris CGA009)
MDATATTPNGDDAPPARVDLRAEFNEVGIGEVLDQLDRELIGLKPVKTRIREIAALLLVE
RLRKRMGLATGNPTLHMSFTGNPGTGKTTVALRIASILHKLGFVRRGHVVSVTRDELVGQ
YIGHTAPKTKEVLKKAMGGVLFIDEAYYLYRPENERDYGQEAIEILLQVMENQRDDLVVI
LAGYADRMEKFFQSNPGFRSRIAHHIDFPDYTDGELLTIAEGMLSEQNYHFAPEAKAAFE
RYIGIRKTQPLFANARSIRNALDRIRLRQANRLIADLDRSLSAEDLMTIEAGDVLASRVF
GKEDGRDR