Protein Info for TX73_007950 in Rhodopseudomonas palustris CGA009

Annotation: BCD family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 354 to 380 (27 residues), see Phobius details amino acids 389 to 411 (23 residues), see Phobius details amino acids 431 to 455 (25 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 399 (360 residues), 40.6 bits, see alignment E=1.6e-14 PF03209: PUCC" amino acids 55 to 458 (404 residues), 460.1 bits, see alignment E=7.1e-142

Best Hits

Swiss-Prot: 59% identical to PUCC_RHOSU: Protein PucC (pucC) from Rhodovulum sulfidophilum

KEGG orthology group: K08226, MFS transporter, BCD family, chlorophyll transporter (inferred from 100% identity to rpt:Rpal_1735)

Predicted SEED Role

"PucC protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>TX73_007950 BCD family MFS transporter (Rhodopseudomonas palustris CGA009)
MSQVAATLAKGWMRLGTRFLPFADAATKELPLGRLLRLSLFQVSVGASIVLLNGTLNRVM
IVELGVTTLLVSLMVSLPLVFAPFRVLIGFKSDHHRSVLGWRRVPYIWMGTLLQFGGFAI
MPFALLVLSGEGAYPAVYGQFGAALAFLLVGAGLHTTQTAGLALATDIAPEDSRPRVVAF
LYVMLLIGMTGSAIIFSELLRDFSELKLIQVIQGVAVVQLLLNIVALWKQEARNPALTAA
SRQRPQFGESWAQFRAAGGSTRMLVAVALGTAGFSMQDILLEPFGAQVLQLTVGQTTALT
AFFAIGTLAGFALAARTLGRGGDPYRLAGLGAMIGMFAFAAVVISAPAQSVLLFRVGTAL
IGFGGGLFAAGTLTAAMAVASGSDSGMALGTWGAVQATAAGGGILLGGGIRDAVASLASD
GTLGAVLSGPAIGYCFVYYIEIALLFATLVAVGPLVRTTRTNYAQSSAKFGLAEFPG