Protein Info for TX73_007875 in Rhodopseudomonas palustris CGA009

Annotation: BCD family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 104 to 131 (28 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 395 to 419 (25 residues), see Phobius details PF03209: PUCC" amino acids 30 to 422 (393 residues), 332.7 bits, see alignment E=5.4e-103 PF07690: MFS_1" amino acids 36 to 376 (341 residues), 62.6 bits, see alignment E=4.9e-21 PF03092: BT1" amino acids 84 to 230 (147 residues), 22.7 bits, see alignment E=6e-09

Best Hits

KEGG orthology group: K08226, MFS transporter, BCD family, chlorophyll transporter (inferred from 100% identity to rpt:Rpal_1720)

Predicted SEED Role

"Bacteriochlorophyll synthase 44.5 kDa chain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>TX73_007875 BCD family MFS transporter (Rhodopseudomonas palustris CGA009)
MVRPLSWLGIIRMGLVQTGLGAIVVLTTSTLNRVMVVELALPAMLPGALVAIHYALQVFR
PAWGHGSDRGSRRTPWIIGGMAVLALGGFLAAVATAWMTVQPLFGTALAIVAFCLIGGGV
GAAGTSLLVLLAKRTDEKRRAAAATIVWVMMIAGFIVTTAIAGQLLDPFSPQRLIAVSGG
VSLIAMVLTFAGVWGVEGRAAVAAPAAAPKGSFRKAFLEVWHEPQARRFAIFVFVSMLAY
SAQDLILEPFAGAVFGFTPGETTKLSSVQHGGTLIGMAMVPIIGALFPKTRGNLQIWTIG
GCIASAIALLGLSSAAIVGPSWPLRSTVFMLGVTNGAYAVAAIGSMMELVGAGGEHREGV
RMGLWGAAQAIAFGIGGFIGTLASDLARLILGAPALSYAAVFAAEAGLFVVSAAMAVWVH
RAQNRRDVDLTNAAVAGG