Protein Info for TX73_007865 in Rhodopseudomonas palustris CGA009

Annotation: transcriptional regulator PpsR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 TIGR02040: transcriptional regulator PpsR" amino acids 29 to 472 (444 residues), 482.1 bits, see alignment E=1.9e-148 PF00989: PAS" amino acids 163 to 258 (96 residues), 22.6 bits, see alignment E=2.2e-08 PF02954: HTH_8" amino acids 433 to 470 (38 residues), 38.1 bits, see alignment 2.5e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA1529)

Predicted SEED Role

"Regulator of carotenoid biosynthesis; Transcriptional regulator, PpsR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>TX73_007865 transcriptional regulator PpsR (Rhodopseudomonas palustris CGA009)
MLEDICPGASVQISEGVAGDLGAQSAAKLIAAATDVALVVDPQGVIRDVAFTREELAHEL
DGQSRWLGARLVDIVTSDTQPKIRELLLDATVRDAPTWRQVNHPSPNGEDIPVLYSAINF
GRDDRLLVVGRDLRQLAMMQQRLINAQQSMERDYIRLRHAETRYRLLFQVSSEAVMIVDA
ASELIVDANPATLALFDTSAPEALNAPVIGFVDGADQQTVLNLFADVRSTGRDGRARIKL
ADGRRECELSASLFRQENASLYLVRLASHGAPPEAGSAKTASLLLNYFESAADAVVITQY
DGRVVRANLAFLEMAQLGSAEQARGELLDRWLGRTGVDLSVALANLRQSGTIKLFATVLR
GEYGAVAEVEVSAVALKDSDDKPCFGFAIRNVEKRLTTAATSKRELPRSVAQLTELIGRV
PLRDLVRETTDVIEKLSIEAALELTGDNRASAADMLGLSRQSLYVKLRRYGLAEHAPEGD
GADE