Protein Info for TX73_007765 in Rhodopseudomonas palustris CGA009

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR03056: putative magnesium chelatase accessory protein" amino acids 12 to 289 (278 residues), 335 bits, see alignment E=1.4e-104 PF00561: Abhydrolase_1" amino acids 40 to 126 (87 residues), 71.2 bits, see alignment E=1.6e-23 PF12146: Hydrolase_4" amino acids 40 to 196 (157 residues), 40.2 bits, see alignment E=3.8e-14 PF12697: Abhydrolase_6" amino acids 42 to 282 (241 residues), 88.2 bits, see alignment E=1.9e-28

Best Hits

Swiss-Prot: 40% identical to BCHO_RHOCA: Magnesium-chelatase 30 kDa subunit (bchO) from Rhodobacter capsulatus

KEGG orthology group: K06049, magnesium chelatase accessory protein (inferred from 100% identity to rpt:Rpal_1698)

Predicted SEED Role

"Alpha/beta hydrolase fold (EC 3.8.1.5)" (EC 3.8.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.5

Use Curated BLAST to search for 3.8.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>TX73_007765 alpha/beta fold hydrolase (Rhodopseudomonas palustris CGA009)
MSDLVWSRDGLDWPHREASRFIEAGGFRWHVQRMGSPAAPAILLIHGTGAASHSWRGLAP
LLSRHYHVVAPDLPGHGFTQTPRGHRMSLPGMASDLAALLRVLQVAPQLVVGHSAGAAIL
ARMCLDGSIDPKILFSLNGAFLPYGGPAASFFSPLAKMLVMNPFVPSLFAWQAGHRGAVE
RLIGNTGSTIDPAGIKLYGKLVSSPNHVAAALRMMANWDLEPLLKALPNLKPLLVLVAAE
GDRAIPPSVAVKVREILPKAVIERIPALGHLAHEERPALIAALIERYAEKLENIE