Protein Info for TX73_007590 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01547: SBP_bac_1" amino acids 51 to 279 (229 residues), 26.7 bits, see alignment E=8.2e-10 PF13343: SBP_bac_6" amino acids 74 to 320 (247 residues), 174.1 bits, see alignment E=5.5e-55 PF13531: SBP_bac_11" amino acids 124 to 283 (160 residues), 40 bits, see alignment E=6.2e-14

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to rpt:Rpal_1663)

Predicted SEED Role

"putative periplasmic solute-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>TX73_007590 ABC transporter substrate-binding protein (Rhodopseudomonas palustris CGA009)
MRLVRLMTALCALSAFASLQPAKAADVICYNCPPQWADWATMLKQVKADLGYDIPFDNKN
SGQALSQLIAEKSNPVADIGYFGVNFGMKAKAQGVTQPYKPAKWDEVPAGLKDPDGEWTA
IHSGTLGLFVNVDALGGKPVPACWRDLEKPDYKGMVGYLDPPSAAVGYVGAVAVNLALGG
SDQDFSPAVLFFKKLHDNDAIVPKQTSYARVVSGEIPILFDYDFNAYRAKYTEKGNFAFV
IPCEGSVVFPYVVSLTKGAPNADKAKKVMDYLLSDKGQAIWTNAYLRPARPIALPPEVKA
KFLPDSDYARAKNVDWAKMEAAQKAFTDRYLAEVR