Protein Info for TX73_007425 in Rhodopseudomonas palustris CGA009

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF00005: ABC_tran" amino acids 35 to 184 (150 residues), 106.6 bits, see alignment E=1.8e-34 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 236 to 324 (89 residues), 85.5 bits, see alignment E=1.1e-28 PF08352: oligo_HPY" amino acids 237 to 304 (68 residues), 58.7 bits, see alignment E=5.9e-20

Best Hits

Swiss-Prot: 54% identical to Y2547_BRUO2: Putative peptide import ATP-binding protein BOV_A0347 (BOV_A0347) from Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to rpa:RPA1445)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>TX73_007425 ATP-binding cassette domain-containing protein (Rhodopseudomonas palustris CGA009)
MTEPVSASPSDVIAVRDLRILFPTRDGHDTVKAVDGMDFEVRTGETFGIIGESGSGKTTL
GRALVSLLKPTEGQILHQGVDPAALGARAFRKHRRDFQIVFQDPNAALNPRMTIIDSVME
PLEIVGEGDAVSRRRRGIAALERVGLSPEAADRYPHQLSGGQKQRVNIARVLTLRPKVIV
CDEVVAALDVSIRGDVLNLFADLQREFGLTYVFITHDISVVSHISDRIAVTYLGKLMELG
PAEDVIEHPLHPYTRALLSAEPIPLPSHLRVDRRIILEGEIPSPVAPPSGCRFRTRCPSV
RPRCADEVPAWREVRPGHRVACHFATADGPPPDQRQAQNTTIMGEPTCA