Protein Info for TX73_007290 in Rhodopseudomonas palustris CGA009

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF16576: HlyD_D23" amino acids 139 to 351 (213 residues), 236.2 bits, see alignment E=3.9e-74 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 247 to 424 (178 residues), 115 bits, see alignment E=1.8e-37 PF13437: HlyD_3" amino acids 249 to 347 (99 residues), 69.3 bits, see alignment E=6.7e-23 PF00529: CusB_dom_1" amino acids 279 to 418 (140 residues), 27.5 bits, see alignment E=3.7e-10

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 100% identity to rpa:RPA1421)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>TX73_007290 efflux RND transporter periplasmic adaptor subunit (Rhodopseudomonas palustris CGA009)
MTKLRSPSLLFLIGLCLASPAAADERSPLYYRDPSGAPRWSAVPKADAQGRAYLPVYEAD
EPSAQPAPKPAADPTRKILYYRNPMGLPDISKVPKKDSMGMDYVPVYEGEDSADGTVKLS
PGKIQRSGVKSESAERRALHVMVKAPGVIQLDERRVSVIAMRSESFVEKIADVTTGSVVK
AGQPLMQIYSSAIASAAAEYLSTITSKNSSTIEAFGRGSRQRLVNLDVPDETIAELERTR
TAPVTVQWRAPRDGIVLERNAIDGMRANVGDVLFRIADISTVWALVDVAERDLGTLSVGQ
KVTIRARAFPDRALSGTIAVIYPQVNRDTRTTRLRVELANPDLKLLPDMYVDAEIDIAGN
APALTIPTSAVLDNGSRRIVLVDKGDGRFEPRTVTLGRRGDGVVEVKHGIDEGEAVVTSA
NFLIDAESNLKAALKGFADGANAPTNEPQTSSHNHAHDHAGAQP