Protein Info for TX73_007170 in Rhodopseudomonas palustris CGA009

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 8 to 30 (23 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 192 to 217 (26 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 279 (184 residues), 46.6 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to rpa:RPA1397)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>TX73_007170 carbohydrate ABC transporter permease (Rhodopseudomonas palustris CGA009)
MADRPLPWSLLVVLLGAIFVTLFPIFWIVMTAIKPPTDWNAVPAIWIPSEPTLVNFRTLF
NPEAIREYGVGGVSQAATMSVLGSILSSTTATLLSVTIGLLSAIGISRYSSGGRATPLMI
LSGRMFPPAAIAVPFVIIFSSIGLIDTYSGLIAIYVAATLPFSTWMLKSFVDEIPREIEE
AAMVDGKSRLMAHLTVTLPLIRGGLFATTLFIFILNWSEFLFALVLSYTNIETIPVRLAK
YVTATAGTLYGVQAALAVLAMAPLVIAGFLIQNHLARGMTFGAIKR