Protein Info for TX73_007165 in Rhodopseudomonas palustris CGA009

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 66 to 88 (23 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 211 to 236 (26 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 317 to 341 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 141 to 332 (192 residues), 66.7 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to rpa:RPA1396)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>TX73_007165 sugar ABC transporter permease (Rhodopseudomonas palustris CGA009)
MASTRASERRVDRERSPSRRPVTFAWTKDRVLDASTYSNERQPVLQHEPSPGRPGASRRR
WFARGLLLPGQILSLMVLITPLLVAFYMSFTDWAPTRGGLAAARFVGIENYQELLIYDTR
FVEAVVRTLLLSAVCLSIEFALGLGLAVLFLRRFRGKAVAFSVVLTPMMVLPVVVGYTFW
MLFQSNGPVNQIIELIAGPGSAPEWFRSTPFALAIVVITEVWHWTPLFFLILLSGLNALP
ENPVRAAVILGASPRQIFWRVVLPMLKPVIVVAFVIRSMEIVKLFDEVFMLTRGGPGTST
ETVSLYIYKLAFNDFQLAYGAAAAFLVLLGTLTLVHLLLAPVRDQLLEERR