Protein Info for TX73_007055 in Rhodopseudomonas palustris CGA009

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 PF13185: GAF_2" amino acids 45 to 187 (143 residues), 58.3 bits, see alignment E=3e-19 PF01590: GAF" amino acids 46 to 185 (140 residues), 58.8 bits, see alignment E=2.6e-19 PF00158: Sigma54_activat" amino acids 219 to 385 (167 residues), 246.1 bits, see alignment E=4.5e-77 PF14532: Sigma54_activ_2" amino acids 220 to 390 (171 residues), 72.6 bits, see alignment E=1.2e-23 PF07728: AAA_5" amino acids 243 to 362 (120 residues), 32.1 bits, see alignment E=3.2e-11 PF02954: HTH_8" amino acids 482 to 522 (41 residues), 46.9 bits, see alignment 5.6e-16

Best Hits

Swiss-Prot: 71% identical to ANFA_AZOVI: Nitrogen fixation protein AnfA (anfA) from Azotobacter vinelandii

KEGG orthology group: K02584, Nif-specific regulatory protein (inferred from 100% identity to rpa:RPA1374)

Predicted SEED Role

"Nitrogenase (vanadium-iron) transcriptional regulator VnfA" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (543 amino acids)

>TX73_007055 sigma-54-dependent Fis family transcriptional regulator (Rhodopseudomonas palustris CGA009)
MNLSEIVQVEVDDLTEEFSHCFTGECRVNVLPLLYQISKIITESEDLAKTLTLILSVMQH
QLKIHRGVVTLYDRESQTIFIHESFGLTEDQKARGLYAPGEGITGQVVESGKPIIVPHLR
EDSRFLDRTKAHSDGNGNASFFCVPIIHGRKVLGTISAERGYRNRRLLKQDVEVLSTIAS
MIAPAVELYLLENVDKVRLENENRRLQSELKERFKPSNIIGNSKPMQAVYDLIQKVATTK
TTVLILGESGVGKELVANAMHYNSGNADGPFVKFNCAALPENIVESELFGHEKGSFTGAV
GMRKGRFELADGGTIFLDEVGELSLPMQAKLLRVIQERTFERVGGNKPVKVDLRIIAATN
RNLLDMVAKGTFREDLYYRLNVFPITIPPLRDRGSDVVLLADHFVARSAAAAGKDVKRIS
TPALNMLMAYHWPGNVRELENVIERSVILSDDGVIHGYNLPPSLQTSEETGTNFGCSMEA
KVEAVEYEMIVEALKTHNGNTTEAAKELGLTRRVLGLRIEKYGIDYRIYRRSYIAKQAAK
QKA