Protein Info for TX73_006810 in Rhodopseudomonas palustris CGA009

Annotation: protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07714: PK_Tyr_Ser-Thr
  • amino acids 118 to 271 (154 residues), 44.7 bits, E=1.1e-15
• PF00069: Pkinase
  • amino acids 123 to 277 (155 residues), 48.1 bits, E=1.1e-16

Best Hits

KEGG orthology group: K00924, [EC: 2.7.1.-] (inferred from 100% identity to rpa:RPA1327)

Predicted SEED Role

"FIG01005993: hypothetical protein"

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Protein Sequence (318 amino acids)

>TX73_006810 protein kinase (Rhodopseudomonas palustris CGA009)
MATSQQTCHGEARCSSEEPRPYQAINRQWWSELALSFTGLADGIETHLAEEKSGRTWRIR
SAAAGTFAAARLEREATLAARVGAAAAELPAYVGNSDKVVLVYPAARRALASLPIGEVAV
DRFLAIAEAAAIALSRVHACDVVHGTLDAGKVLLDENGLVRFAEFGRARLTGQELAPDMS
GLPQIDFKYAAPEQARRDHPVLDTRSDLYALGVILYEFLVGRPPLLAASIADWLHAHVAI
DVLPPSHIRGGIPPAIDAVLLKLLAKDPGQRYQTASELQAEIARIAVLAWSGGRGGHTSL
SVRKAGRPGPSRRRVVWP