Protein Info for TX73_006800 in Rhodopseudomonas palustris CGA009

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 213 (174 residues), 115.1 bits, see alignment E=1.7e-37 PF13533: Biotin_lipoyl_2" amino acids 40 to 87 (48 residues), 49.1 bits, see alignment 9.8e-17 PF16576: HlyD_D23" amino acids 41 to 222 (182 residues), 68.8 bits, see alignment E=1.1e-22 PF00529: CusB_dom_1" amino acids 119 to 279 (161 residues), 31.2 bits, see alignment E=4.4e-11 PF13437: HlyD_3" amino acids 150 to 226 (77 residues), 39.8 bits, see alignment E=1.6e-13

Best Hits

Swiss-Prot: 45% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to rpa:RPA1325)

Predicted SEED Role

"COG1566: Multidrug resistance efflux pump"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>TX73_006800 HlyD family secretion protein (Rhodopseudomonas palustris CGA009)
MLSVLATLAAIAAAAYMGRMLWQAYMAAPWTRDGTVRAYVVGVTPQVSGRISELSVKAAQ
YVRKGDPLMKIDPVDFQIALASAEATVASARADLANKQAEAERRDRLSSLAVSKEEQQIY
TAAAAMAAAALRQALSNLDKARLALSRTEIVSPVDGYVTNLVTQAGDYATSGQRALSIVD
SGSFWVDAYFEETLLRGIRVGDRARVALMAYPQTLAGEVVGIERGIAVPNAESDPSGLAT
VNPVFTWVRLAQRVPVRIALKDVPPSIVLAAGLTATVSIQPNSAPAGAKPIVPSPAE