Protein Info for TX73_006790 in Rhodopseudomonas palustris CGA009

Annotation: FUSC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 58 to 75 (18 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 397 to 415 (19 residues), see Phobius details amino acids 426 to 444 (19 residues), see Phobius details amino acids 450 to 468 (19 residues), see Phobius details amino acids 475 to 495 (21 residues), see Phobius details amino acids 502 to 526 (25 residues), see Phobius details PF04632: FUSC" amino acids 32 to 668 (637 residues), 469.4 bits, see alignment E=2.5e-144 PF13515: FUSC_2" amino acids 45 to 175 (131 residues), 59.3 bits, see alignment E=4.3e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA1324)

Predicted SEED Role

"FIG01005877: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (683 amino acids)

>TX73_006790 FUSC family protein (Rhodopseudomonas palustris CGA009)
MSVFDHSGREARRFWHGLRQAVLSRLQALAPRVLFGLRLSASVCLALFATYYLELQNAFW
AATTAAIVCQPNLGASIQKGRFRAIGSALGALVMVALLAAFPQQREPALLLLALFCGLCA
AAATLLRNLAAYAAALAGITSAIIFADTVTDPSSAPFLAIVRVGEIYIGIWSATVVAMLT
GSGSARRQLCQTLGRISANLLAGFSTDVTSGRGAADSRAARIALARELGPLNLAIDAALG
EQSPVLADRARLRRIPFALLDALTSWRNAARFGERSSVAETTSRGELRASLAAIDPARFQ
SDPAGFRDSCRTALRRIDATRSSDVDAPIVVAARDVVQGLAAAADGMLAKGAVGSNGRTP
RASFVVADPLPALVNGARTAAAILAVTWFWVVTAWPSGPFAIVFTAVATLIFASFGDHAG
DLAKDYTIGVALMAVVGSVLYFGVLPALSSFAALIAVLSVLFIVLGVMQAGPWHSVVFLA
MTISSLPLLGVGNPITYDASAYFNLALAIVSGSAVGAMFFVAIPVVPPSLRLRRLIALSL
RDLRRLLSLRSTPDQLRWTALMARRIELLPSEATADDVADLLALHAVGRAALRLEQEVSD
HRALGLLRAALTALADGHLADARMMLVTWRGQSLALDPPDDAEHRRWIASQSHIAVIIDA
IDNHPVLLATPFRGWQPFFKAFR