Protein Info for TX73_006675 in Rhodopseudomonas palustris CGA009

Annotation: type 1 glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF18011: Catalase_C
  • amino acids 6 to 123 (118 residues), 29.3 bits, E=6.2e-11
• PF01965: DJ-1_PfpI
  • amino acids 8 to 176 (169 residues), 181.2 bits, E=1.4e-57
• TIGR01382: intracellular protease, PfpI family
  • amino acids 10 to 176 (167 residues), 176.5 bits, E=1.7e-56

Best Hits

Swiss-Prot: 42% identical to DEGLY_THEKO: Deglycase TK1284 (TK1284) from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 99% identity to rpt:Rpal_1491)

MetaCyc: 42% identical to archaeal arginyl aminopeptidase monomer (Pyrococcus horikoshii OT3)
RXN-23973 [EC: 3.4.11.27]

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.- or 3.4.11.27

Protein Sequence (187 amino acids)

>TX73_006675 type 1 glutamine amidotransferase (Rhodopseudomonas palustris CGA009)
MAGQLDGKRVAILATHGFEQSELEIPRDRLKAAGAQVDIVSPEQGEIRGWSGKDWGHLVK
VDKLLSAVKADDYDAIVLPGGQINPDLLRVNQDALKLIKSLFDAGKTVAAVCHAPWLLID
TGIAKGRKMTSYNSIKQDVINAGAKWEDSAVVTDNGVITSRNPGDLEAFSAKIIEEMREG
KHQRRAA