Protein Info for TX73_006495 in Rhodopseudomonas palustris CGA009

Annotation: flagellar motor switch protein FliG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 TIGR00207: flagellar motor switch protein FliG" amino acids 33 to 360 (328 residues), 260.1 bits, see alignment E=1.7e-81 PF14842: FliG_N" amino acids 34 to 135 (102 residues), 88.6 bits, see alignment E=8e-29 amino acids 155 to 217 (63 residues), 25.9 bits, see alignment E=2.5e-09 PF14841: FliG_M" amino acids 144 to 217 (74 residues), 89.3 bits, see alignment E=3e-29 PF01706: FliG_C" amino acids 245 to 351 (107 residues), 130.5 bits, see alignment E=6.1e-42

Best Hits

Swiss-Prot: 89% identical to FLIG_BRADU: Flagellar motor switch protein FliG (fliG) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 100% identity to rpa:RPA1265)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>TX73_006495 flagellar motor switch protein FliG (Rhodopseudomonas palustris CGA009)
MADAPVPATSQDDIASVVATLAQRQSGRAPSKPLSGPKRAAILMLALGEQYGGKIWSLLD
DEEVRELSMTMSTLGTIEPETVEDLLLEFVSRMSASGALMGNYDATERLLQKYLPADRVT
GIMEEIRGPAGRNMWEKLSNVSEEVLANYLKNEYPQTTAVVLSKLKPEHAAKVLAILPED
MALDVINRMLRMEAVQKEVIESVEKTLRSEFMSNLSQTRRRDAHEVMAEIFNNFDRQTET
RFITSLEEDNRESAERIKALMFTFDDLVKLDAGSAQTLMRNIDKDKLAIALKSANEEVRG
FFLGNMSSRAGKMLMDDMAALGPVRLRDVDEAQALLVNLAKDLAAKGEIVLTKNRADDEL
VY