Protein Info for TX73_006245 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF19300: BPD_transp_1_N
  • amino acids 1 to 76 (76 residues), 57.9 bits, E=1.1e-19
• PF00528: BPD_transp_1
  • amino acids 113 to 312 (200 residues), 139.6 bits, E=1e-44

Best Hits

Swiss-Prot: 58% identical to Y4TP_SINFN: Probable peptide ABC transporter permease protein y4tP (NGR_a01430) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 99% identity to rpt:Rpal_1409)

MetaCyc: 40% identical to nickel ABC transporter membrane subunit NikB (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"binding-protein-dependent transport systems inner membrane component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Protein Sequence (313 amino acids)

>TX73_006245 ABC transporter permease (Rhodopseudomonas palustris CGA009)
MLGYLIRRLLAAIPVMGVVALFVFLLLRLTPGDPAAIIAGDSATPEQLMRIRTSLGLNEP
LYVQFFTWIGRLLHGDLGVSLISQVPVLQMIGQRIEPTITVALSTIVLSVIVAVPLGVVA
AWKHGTWVDRFVMGLSVIGFSVPVFVIGYVLIQIFAIELRWLPVQGFRPMARGFGPFAER
LVLPTLTLSFIYIALIARMTRAAMLDVLGEDYVRTARAKGINESRVLLRHALRNAAVPVI
TVIGTGFALLISGVVVTESVFNLPGIGRLTVDAVLARDYPVIQGMILLTSGIYVAVNLLI
DLAYTLLDPRIRY