Protein Info for TX73_006130 in Rhodopseudomonas palustris CGA009

Annotation: dienelactone hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01738: DLH
  • amino acids 17 to 222 (206 residues), 163.5 bits, E=5.5e-52

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 100% identity to rpa:RPA1194)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

• 4-chlorocatechol degradation (2/5 steps found)
• 4,5-dichlorocatechol degradation (3/7 steps found)
• 3,4,6-trichlorocatechol degradation (4/9 steps found)
• 3-chlorocatechol degradation I (ortho) (1/5 steps found)
• 3-chlorocatechol degradation II (ortho) (1/5 steps found)
• 3,5-dichlorocatechol degradation (3/8 steps found)
• 1,4-dichlorobenzene degradation (3/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Fluorobenzoate degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.45

Use Curated BLAST to search for 3.1.1.45

Protein Sequence (224 amino acids)

>TX73_006130 dienelactone hydrolase family protein (Rhodopseudomonas palustris CGA009)
MGTLITFKRPDGKEASGYLANAASGRAPGVVVIQEWWGLSEQIKGLTDRLALAGFDALAP
DLYNGTVVPYHDTDAANKEMSSLDFMDATTQTVRGAVNYLSRNGAKVGLTGFCLGGAVTV
IGACKIPELSAAVVFYGIPPEQAAKPADVQVPMQGHFANRDDWCTPQVVDAFEAGLKAAG
KQAEFFRYEADHAFVNEQRAAVHDREAAELAWSRSMQFFGKHLS