Protein Info for TX73_006010 in Rhodopseudomonas palustris CGA009

Annotation: excinuclease ABC subunit UvrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 704 TIGR00194: excinuclease ABC subunit C" amino acids 86 to 679 (594 residues), 538.4 bits, see alignment E=1.2e-165 PF01541: GIY-YIG" amino acids 94 to 167 (74 residues), 32.6 bits, see alignment E=2.5e-11 PF02151: UVR" amino acids 284 to 314 (31 residues), 26.7 bits, see alignment (E = 1.1e-09) PF08459: UvrC_RNaseH_dom" amino acids 458 to 633 (176 residues), 168.7 bits, see alignment E=2.8e-53 PF14520: HHH_5" amino acids 649 to 697 (49 residues), 42.9 bits, see alignment 1.7e-14 PF12826: HHH_2" amino acids 652 to 701 (50 residues), 30.1 bits, see alignment 1.4e-10

Best Hits

Swiss-Prot: 100% identical to UVRC_RHOPA: UvrABC system protein C (uvrC) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 100% identity to rpa:RPA1171)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (704 amino acids)

>TX73_006010 excinuclease ABC subunit UvrC (Rhodopseudomonas palustris CGA009)
MIHDPAEPPAAAAEPPLDTASPDGAAPVADTRPAAGNQDIDAATASLAVEEDDEARLPEV
EDEPEAEPAQAGAGPMAVGRSAIARAVRLAPTSPGVYRMLNAERDVLYVGKAKNVKKRLA
SYARPTGQVLRIARMIALTVEVEVISTTTETEALLLEANLIKQLRPRFNVQLRDDKSFPY
ILITSDHWAPQILKHRGAQSRPGRYFGPFASAGAVNRTITALQRAFLVRSCTDSFFESRT
RPCLLYQIRRCAGPCTGEVDFPGYSELVREATDFLSGRSRAVKELLAAEMEKASGELEFE
TAALYRDRLAALSAIQSQQGINPRTVEEADVFAIHQDGGYSCVEVFFFRTGQNWGNRAYF
PRAEKSFTPAEVLGAFVAQFYDDKPPPKLILLSHEIEEAELLADALCVKAGHKVEITVPK
RGEKKELVAHAQTNAREALGRKLADTATQARLLENLATTLGLPKTPQRIEVYDNSHIQGT
NAVGAMIVAGPDGFIKNQYRKFNIRSEGLTPGDDYAMMREVLQRRFKRLVTSQAEGDGEA
AAKAKPKDDDVPQWPDLVIIDGGRGQLNAAREALSGIGLTDQVTLLGVAKGPDRDAGRET
LFLPDRDAIKLEPRDPVLYFIQRLRDEAHRFVIGSHRTLRKKDIREAGLQEIPGIGPTRK
RALLLHFGTLKEIERASIADLGKVPGISAESAKRIFEFFHARPD