Protein Info for TX73_005895 in Rhodopseudomonas palustris CGA009

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 252 to 273 (22 residues), see Phobius details amino acids 285 to 310 (26 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 22 to 163 (142 residues), 37.9 bits, see alignment E=1.8e-13 PF00535: Glycos_transf_2" amino acids 23 to 184 (162 residues), 94.8 bits, see alignment E=6e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_1339)

Predicted SEED Role

"Polymyxin resistance protein ArnC, glycosyl transferase (EC 2.4.-.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.4.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-

Use Curated BLAST to search for 2.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>TX73_005895 glycosyltransferase family 2 protein (Rhodopseudomonas palustris CGA009)
MMLGSDVSGLSTEAGTAAALGLSIVVPAYNEAGGLQALHGRLITLAATLRQRYGLACEVV
YVDDGSSDTTLSIARNLPATMLDVQVVSLSRNFGKEAALMAGLDHASRGAVLFMDGDGQH
APELVETLVGHWIEDGFDVVYTAKAHRDNEPALRRAAVRSFYTLINWGARQKIPEDAGDF
RLLSPRAAQALRQLPERNRFFKGLASWIGFRQKRVDYEPEPRSHGFSTFSTARLIGLSIE
GLTSFSVAPLRIASLLGVVLAISAFLFGLSILWETWIDGKSVPGYPSIIVGMMTIGGVQL
LMIGIVGEYIGKILSEMKARPIYFVAEHSVKRADTDAGDPAKRSAAE