Protein Info for TX73_005830 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 17 to 296 (280 residues), 212.1 bits, see alignment E=1.6e-66 PF05992: SbmA_BacA" amino acids 33 to 346 (314 residues), 161.8 bits, see alignment E=4.4e-51 PF00005: ABC_tran" amino acids 389 to 519 (131 residues), 68 bits, see alignment E=2.2e-22

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to rpa:RPA1135)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (586 amino acids)

>TX73_005830 ABC transporter ATP-binding protein/permease (Rhodopseudomonas palustris CGA009)
MSNIKGTLATAWRIAAPYFSAEDKWMGRGLLAAVVVIELAVVGLSVLFNRWNNVFYNALQ
ERNYDVFTYQIIYFCVLAAIWIALKVYQLYLNQWLQIRWRKWMTERYLGGWLHDANHYQM
QLTGDAADNPDQRIAEDTQLFVERTLALGIGLLNAVVTLASFVVILWGLSNEAPLHLFGQ
DVPIPGYLVWGALIYAALGTALTHWIGSPLVDLNFRQQRYEADFRFNLVRARENAEQIAL
LRGEPAERDKLSSRFSYVAENFMRIMSRTKRLTAFTASYSQASIIFPYILVAPAFFAQKV
QLGGMMQTASAFGSVQDSLSFFITAYRTLAEWQSVLQRLDGFERAIEGAATRRDNPGVMR
VPAAAGGIELKDLNLTLPAGAPLISADGFKIGDNERTLIVGPSGAGKSTLFRAIAGIWPF
GSGSIAIPADATLMMLPQRPYFPVGELRAAIVYPAESGAFSDAQVAEVLREVGLPALAER
LDQHGHWNRTLSLGEQQRLGIARALLHAPQYLFLDEATASLDEPSEAALYKLLDRKLPGT
TIVSIGHRSTLEAFHQRDAVLSRTGDGFTLHDRAKAAAPEVGLAGS