Protein Info for TX73_005770 in Rhodopseudomonas palustris CGA009

Annotation: peptidoglycan-associated lipoprotein Pal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02802: peptidoglycan-associated lipoprotein
  • amino acids 58 to 160 (103 residues), 140.9 bits, E=6.8e-46
• PF00691: OmpA
  • amino acids 60 to 148 (89 residues), 82.1 bits, E=1.6e-27

Best Hits

Swiss-Prot: 65% identical to PAL_RHIME: Peptidoglycan-associated lipoprotein (pal) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03640, peptidoglycan-associated lipoprotein (inferred from 99% identity to rpx:Rpdx1_1293)

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Protein Sequence (165 amino acids)

>TX73_005770 peptidoglycan-associated lipoprotein Pal (Rhodopseudomonas palustris CGA009)
MTNHKRILQGLKVAAVLAVALSMGACANKNGLGGADGAMAGAATPGSQQDFVVNVGDRVF
FESDQSDLSPQAAATLDKQVQWLQTYSRYTFTIEGHADERGTREYNIALGARRAQSVRNY
LVSRGIDAQRMRTISYGKERPVAVCNDISCWSQNRRAVTVLNAGA