Protein Info for TX73_005740 in Rhodopseudomonas palustris CGA009

Annotation: protein TolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 29 to 54 (26 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details TIGR02796: protein TolQ" amino acids 18 to 230 (213 residues), 281.2 bits, see alignment E=2.9e-88 PF01618: MotA_ExbB" amino acids 117 to 218 (102 residues), 127.7 bits, see alignment E=1.2e-41

Best Hits

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 100% identity to rpx:Rpdx1_1287)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>TX73_005740 protein TolQ (Rhodopseudomonas palustris CGA009)
MNPADVTQLAPAVSTDVSLLSLFWHAHWVVKSIMLGLLGCSVWVWAIAIDKLLLFSRTKR
AMDRFEQAFWSGESIDELYRALSAKPTHSMAACFVAAMREWKRSFESHSRSFAGLQMRIE
KVMNVSIAREVERLERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAP
GIAEALFATAIGLIAAIPATIFYNKFTSEVNRQTQRLEGFADEFSAILSRQIDERT