Protein Info for TX73_005705 in Rhodopseudomonas palustris CGA009

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00106: adh_short" amino acids 8 to 196 (189 residues), 203.7 bits, see alignment E=4.3e-64 PF08659: KR" amino acids 9 to 163 (155 residues), 45.3 bits, see alignment E=1.9e-15 PF13561: adh_short_C2" amino acids 13 to 245 (233 residues), 245.2 bits, see alignment E=1.4e-76 PF23441: SDR" amino acids 57 to 244 (188 residues), 31.7 bits, see alignment E=2.2e-11

Best Hits

Swiss-Prot: 38% identical to GOLD_LISIN: NAD-dependent glycerol dehydrogenase (golD) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_1300)

MetaCyc: 40% identical to 2-hydroxy-4-isopropenyl-cyclohexan-1-carboxyl-CoA dehydrogenase (Castellaniella defragrans)
1.1.1.-

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>TX73_005705 SDR family NAD(P)-dependent oxidoreductase (Rhodopseudomonas palustris CGA009)
MTASSPHVALVTGAARGIGLAAAKRFLADGWSVALLDRDDDGLRAAMQALALPERTIALH
CDVADRGSVARDIAAVTERFGRLDALVNNAGIAVFKPLMETTPDEWQRVMDVNLTGPFLM
TQAAVPLMRDSGGGAIVNITSISSLRASTLRVAYGSSKAGLAHFTKQCAVELAALGIRVN
GVAPGPVDTAMAKQVHTADIRSDYRDAIPMARYGLEEELAEAIFFLCSDRASYITGQILA
VDGGFDAAGIGLPSLRGERKNS