Protein Info for TX73_005545 in Rhodopseudomonas palustris CGA009

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 32 to 59 (28 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 331 to 357 (27 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 296 (257 residues), 104.4 bits, see alignment E=6.2e-34 amino acids 283 to 420 (138 residues), 46.8 bits, see alignment E=2.1e-16 PF00083: Sugar_tr" amino acids 71 to 209 (139 residues), 64.9 bits, see alignment E=7e-22 amino acids 241 to 424 (184 residues), 36.1 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_1269)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>TX73_005545 MFS transporter (Rhodopseudomonas palustris CGA009)
MTTSSSTVAPITDTSLTGFYKDMTVTEKRTFWACATGWALDGMDFMIYPLVIGTIIALWK
VDAGSAGLAGTVTLLASAVGGWAAGYLADRIGRVRTLQLTIIWFSLFSLLCAFAQNFEQL
LILRALLGFGFGGEWAAGAVLIGETIRPQYRGRAVGSVQSGWAVGWGMAVLAQAALFSLL
PPEEAWRWMFAIGALPALLVLYLRAYVKEPQVAVEARAKVSAAGGSRSILAIFQGRILKT
TILASLVATGCQGGYYAITFWVPRFLTTERKLSIVGSTGYLATLIVGSFVGYLVGAWFAD
RFGRRSLFLTFSLGAMVVVLAYTQLPLSNELLWVLGFPLGFFASGYFSGMGAFLTELFPT
SLRGSGQGFCYNFGRGVGALFPFLVGYLSQVTTLANAICLFAVFAYVLFFAAAYALPETR
GRVLSADE