Protein Info for TX73_005420 in Rhodopseudomonas palustris CGA009

Annotation: L-aspartate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 PF01266: DAO" amino acids 15 to 199 (185 residues), 36.4 bits, see alignment E=9.1e-13 PF00890: FAD_binding_2" amino acids 15 to 387 (373 residues), 282.5 bits, see alignment E=1.4e-87 TIGR00551: L-aspartate oxidase" amino acids 15 to 497 (483 residues), 486.4 bits, see alignment E=4.6e-150 PF02910: Succ_DH_flav_C" amino acids 431 to 511 (81 residues), 47.1 bits, see alignment E=4.6e-16

Best Hits

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 100% identity to rpa:RPA1054)

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (538 amino acids)

>TX73_005420 L-aspartate oxidase (Rhodopseudomonas palustris CGA009)
MSTTPEFAHLGVHGDVVIVGGGLAGLFCALKLAPRPVTVISAAPLGEGASTAWAQGGIAA
AVGEGDSAESHAADTIAVGAGLVDEAVAHRLAGEAAARIHDLLSYGVPFDRDLEGRLAVA
REAAHSARRIVHVRGDMAGQAIISALTEAVRNTPSIKVIEGWFADGLLMHDDAVAGLRLR
KVGNAAGSPMHIAARAVVLATGGIGHLYAVTTNPIEARGVGLAIAARAGARIADPEFVQF
HPTAIMVGRDPAPLATEALRGEGAILINGQGERFMLAAHPLAELAPRDIVARGVFAEVAS
GRGAYLDATKALGAHFAEHFPTVYESCISAGIDPATQPIPIAPAAHYHMGGIAVDMRGRS
SLHGLWAAGEVSCTGAHGANRLASNSLLEAVVYAARIAEDIASTELAATKSRLDVHETHS
TPIDPAQELLLRQTMAGKVGVVRDRDGLTEAVRTFAALEAETTSTTLANMATTALLVATA
ALARTESRGAHYRADYPTENPAQAKRTTTSLAQARERAAALGGGAPRSPRLSAQSALA