Protein Info for TX73_005320 in Rhodopseudomonas palustris CGA009

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 112 to 137 (26 residues), see Phobius details amino acids 161 to 190 (30 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 248 to 272 (25 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details PF13231: PMT_2" amino acids 63 to 221 (159 residues), 55.9 bits, see alignment E=3.1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA1035)

Predicted SEED Role

"Mll1762 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>TX73_005320 glycosyltransferase family 39 protein (Rhodopseudomonas palustris CGA009)
MRFASLIVELIRARPLLVFWLVVCAQALLWILVPTLFYASPPGDVAVVLAYGREYQVGTD
LGPPLAFWLADVAYRAAGNHMIGVYALAQLCFVVTFYALFQLARAVVGPQYAVVAVLLTS
TVTAFAGSGVEFGPLILARPLWALVLWHGWQVIGQHRRAAWFALSIEIGLLLLTTVAAPA
LLVLPLAFALANARCRRALVSLDTVFALLVIAVLALPYGVWLLRADQFALPALPTTAELG
DRALLGLKLFGGLAISLAGIALLAVLNIGRFAPKHHDAPMIARPPVDPLARQFVYVFALV
PPIVASIAAAVFGLGHVVGGPGVVLLLAGLAVMILIGDVLYLHRQRLLRSAWAALIAAPA
VVVIFTVVVQPWLSRTEVPTSLPAKQMAQFFADSFERRTGKPLPAVAGDPQLASLIALAP
SRPHLFLDATPARTPWVTQGDFDRNGGVVVWRAADTAGKPPDDIAQRFPGIVPELPRGFD
RMISGRQPLLRIGWAIVRPKAP