Protein Info for TX73_005210 in Rhodopseudomonas palustris CGA009

Annotation: cytochrome c oxidase accessory protein CcoG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 31 to 48 (18 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 26 to 469 (444 residues), 529.5 bits, see alignment E=3.5e-163 PF12801: Fer4_5" amino acids 87 to 125 (39 residues), 34.3 bits, see alignment 5.4e-12 PF13746: Fer4_18" amino acids 209 to 316 (108 residues), 129.2 bits, see alignment E=2.6e-41 PF11614: FixG_C" amino acids 352 to 477 (126 residues), 103.1 bits, see alignment E=3.5e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA1013)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>TX73_005210 cytochrome c oxidase accessory protein CcoG (Rhodopseudomonas palustris CGA009)
MTETNIEGPLYAPRKKVYPQAVHGRFRRIKWALLAITLSIYYFTPFLRWNRGPGLPDQAV
LIDLPARRFYFFFIELWPQEVYYFTGLLIIAALVLFLMNALAGRVWCGYLCPQTVWTDLF
YAVERLIEGDRRDRITKDKHGLTVRRVGELALKHFIWLMIAWWTGGAWVLYFADAPTLVK
ELVTFQAPMVAYVWIGILTFTTYTLAGFMREQVCIYMCPWPRIQAALTDEWALNVTYKYD
RGEPRMSVKKAEVVRAHGETAGDCIDCHQCVNVCPTGVDIRQGLQLGCVQCGLCIDACNT
VMQQVGRPPDLIAYDTDINIQRRLAGKPSVYRPIRARTLLYSGLIVLVGAVMVYALATRG
SLDINVLHERNPLFVTLSNGGVRNDYTVRLLNKRPTGRVMQVSVSGVPGARLQAVGVDPD
AKDRLDVEVGQDQTRELRLSVMVPSEQVPGKSMNITFEVKDPQTGEMATAVDHFVPPTSN