Protein Info for TX73_005040 in Rhodopseudomonas palustris CGA009

Annotation: sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 62.6 bits, see alignment E=1.2e-20 PF00158: Sigma54_activat" amino acids 170 to 330 (161 residues), 225.2 bits, see alignment E=1.2e-70 PF14532: Sigma54_activ_2" amino acids 180 to 335 (156 residues), 69.6 bits, see alignment E=1e-22 PF07728: AAA_5" amino acids 188 to 306 (119 residues), 27.6 bits, see alignment E=8.1e-10 PF02954: HTH_8" amino acids 432 to 472 (41 residues), 51 bits, see alignment 2.9e-17

Best Hits

Swiss-Prot: 77% identical to HOXA_BRADU: Hydrogenase transcriptional regulatory protein HoxA (hoxA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_1171)

Predicted SEED Role

"Hydrogenase transcriptional regulatory protein HoxA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>TX73_005040 sigma-54 dependent transcriptional regulator (Rhodopseudomonas palustris CGA009)
MSGQATVLVVDDEIRSLESLKRVLCDEFEVICARDAGEARRVLESEIVHAILCDQRMQYE
TGVDFLKDVRKTWPDPVRMIISGYSDSEDIIAGINEAGIYQYIAKPWHPDRLLDIVRGAV
QLFMLQKETETAGIDIKLTPERAQRVVTEKRGAARKLYEFDRIVHAPDSPLSEVIELGKR
AAEFDISVLITGESGTGKELLARAIHYGSARSGKAFVVENCGALPDELLESELFGCKKGA
FTGAYQDRIGLFEVADGGTIFLDEIGETSPAFQVKLLRVLQESEIRPLGAQRVRKVDVRV
VAATNRDLEAEVRAGRFRRDLYYRLAAFPLHMPALRERPMDVPLIAAKVLADVAKSYGRN
VAGFATGALNRMRHYDWPGNVRELQNEIQRMVVLATEDRLQEGDLSPRVRQGGEPIQLKP
VRNGCATLKTNIEALERHMISEALDRHGGNISRVAGELGLSRVGLRNKLGRYDLRKGLAD
EV