Protein Info for TX73_004975 in Rhodopseudomonas palustris CGA009

Annotation: HupE/UreJ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 118 to 134 (17 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details PF04955: HupE_UreJ" amino acids 13 to 193 (181 residues), 201.9 bits, see alignment E=6e-64 PF13795: HupE_UreJ_2" amino acids 36 to 140 (105 residues), 26.7 bits, see alignment E=4.2e-10

Best Hits

Swiss-Prot: 52% identical to HUPE_RHILV: Protein HupE (hupE) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K03192, urease accessory protein (inferred from 100% identity to rpa:RPA0966)

Predicted SEED Role

"Nickel-binding accessory protein UreJ-HupE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>TX73_004975 HupE/UreJ family protein (Rhodopseudomonas palustris CGA009)
MTHLLRAGTALIALLGLSGLAEAHTGVHLMAADGFAAGFVHPFSGLDHLLAMVAVGLWAW
SLGGAARWIVPASFVALLACGAVLGASGISLPAVEPMIALSVIALGVLVALSVRVPTLAA
AAAVALFGLFHGFAHGAEMPALAQPLAYGAGFVVATALLHGIGLALGATLPRFAPAPSLR
LAGGAIAATGVALALPL