Protein Info for TX73_004840 in Rhodopseudomonas palustris CGA009

Annotation: thiamine phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02581: TMP-TENI
  • amino acids 14 to 188 (175 residues), 60.4 bits, E=7.3e-21

Best Hits

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 100% identity to rpa:RPA0939)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Protein Sequence (219 amino acids)

>TX73_004840 thiamine phosphate synthase (Rhodopseudomonas palustris CGA009)
MNAKPAPSRPAPRLYLATPVTADPAALAAALPKLLAAADIAAVLLRLESSDPRTLTSRIK
AVAPVVQAGGAALLVDGHADLVARGGADGAHLSGIKAMQEWLPQLQPSRIAGVGGLETRH
DSMIAGEAGADYVLFGEPGADGTRPSPEAIAERLDWWAELFEPPCVGYATSCEEVHQFAT
AGADFVLVGDFIWGADDPTAALADAGEALRQGFAAAPRQ